GET /api/protein/UniProt/B0URU5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B0URU5",
        "id": "RNPA_HISS2",
        "source_organism": {
            "taxId": "228400",
            "scientificName": "Histophilus somni (strain 2336)",
            "fullName": "Histophilus somni (strain 2336)"
        },
        "name": "Ribonuclease P protein component",
        "description": [
            "RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme"
        ],
        "length": 119,
        "sequence": "MVKLGFSRELRLLTPSHFKCVFQKPLRVSTPEITILARKNNLEHSRLGLTVAKKHLKRAHDRNRVKRISRESFRLLQGQLANYDFVIITKKGIGNLDNQQLFQTLDKLWKRHIRLVQKS",
        "proteome": null,
        "gene": "rnpA",
        "go_terms": [
            {
                "identifier": "GO:0000049",
                "name": "tRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004526",
                "name": "ribonuclease P activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c1c3f0c110430b6b6339279d367a29870e812f7d",
        "counters": {
            "domain_architectures": 24144,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 24144
        }
    }
}