HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B0T064",
"id": "RL1_CAUSK",
"source_organism": {
"taxId": "366602",
"scientificName": "Caulobacter sp. (strain K31)",
"fullName": "Caulobacter sp. (strain K31)"
},
"name": "Large ribosomal subunit protein uL1",
"description": [
"Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release",
"Protein L1 is also a translational repressor protein, it controls the translation of the L11 operon by binding to its mRNA"
],
"length": 229,
"sequence": "MAKQPKRIQAWTGDREAAHAVAEAIALVKANAKAKFDESIEISVNLGVDPRHADQQVRGVVNLPSGTGRDVRVAVFAKDAKAAEATAAGAEHVGAEDLYEKIVGGFMDFDRVIATPDMMALVGRLGKVLGPRGLMPNPKVGTVTPNVGQAVKDAKGGAVEFRVEKAGIVHAGIGKVSFTDEALLINVKAMVDALVKAKPAGAKGIYVKRIGLSSTMGPGFKIDIASVNA",
"proteome": null,
"gene": "rplA",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0015934",
"name": "large ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5e3872cf7d15195ea5cee583d7e6bb081fb5cc1e",
"counters": {
"domain_architectures": 42125,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 42125
}
}
}