General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B0SP85",
        "id": "NUOD_LEPBP",
        "source_organism": {
            "taxId": "456481",
            "scientificName": "Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)",
            "fullName": "Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)"
        },
        "name": "NADH-quinone oxidoreductase subunit D",
        "description": [
            "NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
        ],
        "length": 406,
        "sequence": "MVMYEKTAEHFGQKFKDLPEGHLLVNLGPSHPATHGILQNVIQIDGERVVDTESVIGYVHRCFEKLGERYDYNQFLVCTDRMNYVSTPLNNIGWILTVEKMMQIQVPDRVTYVRMIISELSRIMDHIICNGIMGVDLGAFSGLLHLFHHRENIYQILEKLTGARLTTTFCRVGGMERDIYPEFQTEIKLILKGLKPALDEFEELLIRNKIFNERTKGIGGISADRAIAYGFSGPNLRAAGVPWDVRKDDPYMFYDKVNFDIPVGEDGSALDRTLVRMEEMRQSMKIIEQLIDGIPEGPYHADVPHSFLPPKDRVYHNMEELIYHFKIIMHGVKVPPGEYYHATEAANGELGFYVVSEGDKSPWRVHVRRPCFWYYQAFPEMVKGGLLADTIATMSSLNVIAGELDC",
        "proteome": "UP000001847",
        "gene": "nuoD",
        "go_terms": [
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048038",
                "name": "quinone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "10402606fa10b66bf9d99416e3ef252c18ea9acd",
        "counters": {
            "domain_architectures": 33063,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33063
        }
    }
}