GET /api/protein/UniProt/B0P6Q8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B0P6Q8",
        "id": "B0P6Q8_9FIRM",
        "source_organism": {
            "taxId": "445972",
            "scientificName": "Anaerotruncus colihominis DSM 17241",
            "fullName": "Anaerotruncus colihominis DSM 17241"
        },
        "name": "Protein RecA",
        "description": [
            "Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage"
        ],
        "length": 392,
        "sequence": "MADKDKKLGSVSARKSGVSSEDRKKALETALGQIEKQFGKGAVMKLGQDSTLNVEAISTGSLSLDIALGIGGVPRGRIIEIYGPESSGKTTVALHVVAQAQKEGGSAVFIDVEHALDPVYAQALGVDIDSLLVSQPDTGEQALEICEALVRSGAIDVVVVDSVAAMVTKAEIEGDMGDSHVGLQARLMSQALRKLTGAIGKSNCVVIFINQLREKIGVMYGNPETTPGGRALKFYASVRLDVRRVEALKNGTELIGNRTRVKVVKNKVSPPFKEAEFDIMYGEGISKVGEILDLATKLDIVVRGGSWFNYGETRLGQGRDNAKEFLKANPEIAQEIETKVRENADKLLKTTKTAGKKPMRAGASAAEPEKLSAAPETPPAPRVNIDVETDDE",
        "proteome": "UP000003803",
        "gene": "recA",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0140664",
                "name": "ATP-dependent DNA damage sensor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008094",
                "name": "ATP-dependent activity, acting on DNA",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006259",
                "name": "DNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003697",
                "name": "single-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "82408aeb490efd567c6f6a430a3b0e54c066ce3a",
        "counters": {
            "domain_architectures": 29002,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 1,
                "profile": 2,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29002
        }
    }
}