GET /api/protein/UniProt/B0N7F4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B0N7F4",
        "id": "B0N7F4_9FIRM",
        "source_organism": {
            "taxId": "445974",
            "scientificName": "Thomasclavelia ramosa DSM 1402",
            "fullName": "Thomasclavelia ramosa DSM 1402"
        },
        "name": "RNA polymerase sigma factor",
        "description": [
            "Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released"
        ],
        "length": 228,
        "sequence": "MFSTLLSLLTNGFFVSYIKSKSFELPLTAKEEERYLEQFFNGDKEARNVLIERNLRLVAHIAKKYENNKDMQEDLISIGTIGLIKAVDSYKQNHKTKLATYASRCIENEILMHLRTNKKTNLDISLNETIGIDKDGSEIVLGDIIAAKQEEFIDIVDKKDTLDKFTTYFSVLEPREKDTLIMRYGLNNTKKYTQKDIAKKLNISRSYVSRLEKRALIKLLREHMKEKP",
        "proteome": "UP000005798",
        "gene": "CLORAM_02537",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a1f5f88f81e39275f708ccac07d5e39020358a9c",
        "counters": {
            "domain_architectures": 32300,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "cdd": 1,
                "profile": 1,
                "ncbifam": 2,
                "panther": 1,
                "pirsf": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32300
        }
    }
}