GET /api/protein/UniProt/B0M9D2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B0M9D2",
"id": "B0M9D2_ANACD",
"source_organism": {
"taxId": "411490",
"scientificName": "Anaerostipes caccae (strain DSM 14662 / CCUG 47493 / JCM 13470 / NCIMB 13811 / L1-92)",
"fullName": "Anaerostipes caccae (strain DSM 14662 / CCUG 47493 / JCM 13470 / NCIMB 13811 / L1-92)"
},
"name": "Stage 0 sporulation protein A homolog",
"description": [
"May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process",
"Required for high-level post-exponential phase expression of a series of secreted proteins"
],
"length": 252,
"sequence": "MLEIILCDDDPFILKIIREQVEHILSESIPEGRIACVASGYQELFLYLKKHPGEYLFFLDLDFGSNEFNGIDIAKQIKKSFPGSKIVFVTNHYELALNVLKSGVEPFGFIEKTTDIMKMNQCCYQYIYLAKKSFPSKESEEDTETVTLKIGTDEELSLPKADILYVEAVKTKSHCICYHTVNGSSITVRETIDHALETLGAGFMKSHRSVIVQKCHMIGLSDGMIKFINGDTVPCSFRQRNEIKGVIYGKQS",
"proteome": "UP000004935",
"gene": "ANACAC_00094",
"go_terms": [
{
"identifier": "GO:0000160",
"name": "phosphorelay signal transduction system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000156",
"name": "phosphorelay response regulator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d88ddc8025a3dba0ebd843f93c84066aef014cfa",
"counters": {
"domain_architectures": 52993,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"profile": 2,
"pfam": 2,
"smart": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 52993
}
}
}