General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B0LV72",
        "id": "B0LV72_9GEMI",
        "source_organism": {
            "taxId": "498805",
            "scientificName": "Emilia yellow vein virus-[Fz1]",
            "fullName": "Emilia yellow vein virus-[Fz1]"
        },
        "name": "Transcriptional activator protein",
        "description": [
            "Strong activator of the late viral genes promoters. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity"
        ],
        "length": 135,
        "sequence": "MRPLSPSGSHSSQIPIKVLHKAAKAKSIRRKRIDLPCGCSIYKSINCHNHGFTHRGTHHCSSSDEWRIYLGGAKSPIFQDPKTPQQTIQHEQGRNRDKDPIQLQPEESIGNSQVFLDIPDMDSLTTSDIAFLKSI",
        "proteome": "UP000207639",
        "gene": "AC2",
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "21ebf865137f01d276c484209b4972ea17d60f2f",
        "counters": {
            "domain_architectures": 4559,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4559
        }
    }
}