General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9XZK6",
        "id": "A9XZK6_9CRUS",
        "source_organism": {
            "taxId": "85135",
            "scientificName": "Nebalia hessleri",
            "fullName": "Nebalia hessleri"
        },
        "name": "Glucosamine-6-phosphate isomerase",
        "description": [
            "Catalyzes the reversible conversion of alpha-D-glucosamine 6-phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion, a regulatory reaction step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis via hexosamine pathway"
        ],
        "length": 176,
        "sequence": "GIPREHPQSYHTFMWENLFKHMDIDPKNVHILNGNAQDLMVECELYENKISEAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLNQETITANARFFGDDMSKVPTQALTVGVGTVMDAREVMVLVTGSHKAYALHMAIETGVNHMWTVSAFQQHPKTIMLCDEDATLELKVKT",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004342",
                "name": "glucosamine-6-phosphate deaminase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006044",
                "name": "N-acetylglucosamine metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "27f4a6754391a05ddd6f38f18b50ac4cb3b55b44",
        "counters": {
            "domain_architectures": 39580,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 39580
        }
    }
}