General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9VT68",
        "id": "HSLV_BACMK",
        "source_organism": {
            "taxId": "315730",
            "scientificName": "Bacillus mycoides (strain KBAB4)",
            "fullName": "Bacillus mycoides (strain KBAB4)"
        },
        "name": "ATP-dependent protease subunit HslV",
        "description": [
            "Protease subunit of a proteasome-like degradation complex believed to be a general protein degrading machinery"
        ],
        "length": 180,
        "sequence": "MGNFHATTIFAVHHNGECAMAGDGQVTMGNAVVMKHTARKVRKLFQGKVLAGFAGSVADAFTLFEMFEGKLEEYNGNLQRAAVEMAKQWRGDKMLRQLEAMLIVMDKTTMLLVSGTGEVIEPDDGILAIGSGGHYALAAGRALKQHASEHLTAKQIAKASLEIAGDICVYTNHNIIVEEL",
        "proteome": null,
        "gene": "hslV",
        "go_terms": [
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005839",
                "name": "proteasome core complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004298",
                "name": "threonine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009376",
                "name": "HslUV protease complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0cadb4b1c9d733ad28db3ac45300c7c0dc1b432",
        "counters": {
            "domain_architectures": 65712,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "cdd": 1,
                "pirsf": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 65712
        }
    }
}