General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9M7H0",
        "id": "A9M7H0_BRUC2",
        "source_organism": {
            "taxId": "483179",
            "scientificName": "Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)",
            "fullName": "Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)"
        },
        "name": "Biopolymer transport protein ExbD",
        "description": [
            "Involved in the TonB-dependent energy-dependent transport of various receptor-bound substrates"
        ],
        "length": 164,
        "sequence": "MAGKVREGGGDDLELNHEINVTPFIDVMLVLLIIFMVAAPLATVDVKVDLPASAAAPAPRPDKPLYVTLKEDLSVSVGNDTVARERLGAALDGLSEKDKETRIFLRADKNVAYGELMRVMNLLREAGYLKIALVGLETVGADQPNAAPASPAAGPAIAPEGAAQ",
        "proteome": "UP000001385",
        "gene": "exbD",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0dc1de7b722f382c0a99228cc8872557ae5c59a",
        "counters": {
            "domain_architectures": 48732,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 48732
        }
    }
}