GET /api/protein/UniProt/A9LM96/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9LM96",
"id": "A9LM96_CISCR",
"source_organism": {
"taxId": "483148",
"scientificName": "Cistus creticus subsp. creticus",
"fullName": "Cistus creticus subsp. creticus (Rock rose)"
},
"name": "Putative 9-cis epoxycarotenoid dioxygenase",
"description": null,
"length": 87,
"sequence": "VVDCMKRVATGGEPYFVPKKTEDGECDEDDGYVMTYIHDATTGESKFLVMDAKSPELSVVAAIRPPRRVPYGFHGLYVSKKQLSSVF",
"proteome": null,
"gene": "NCED4",
"go_terms": [
{
"identifier": "GO:0016702",
"name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d98bee20ce1085859dbded542e56e7cc91a5840c",
"counters": {
"domain_architectures": 25825,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 25825
}
}
}