GET /api/protein/UniProt/A9LM96/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9LM96",
        "id": "A9LM96_CISCR",
        "source_organism": {
            "taxId": "483148",
            "scientificName": "Cistus creticus subsp. creticus",
            "fullName": "Cistus creticus subsp. creticus (Rock rose)"
        },
        "name": "Putative 9-cis epoxycarotenoid dioxygenase",
        "description": null,
        "length": 87,
        "sequence": "VVDCMKRVATGGEPYFVPKKTEDGECDEDDGYVMTYIHDATTGESKFLVMDAKSPELSVVAAIRPPRRVPYGFHGLYVSKKQLSSVF",
        "proteome": null,
        "gene": "NCED4",
        "go_terms": [
            {
                "identifier": "GO:0016702",
                "name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d98bee20ce1085859dbded542e56e7cc91a5840c",
        "counters": {
            "domain_architectures": 25825,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 25825
        }
    }
}