GET /api/protein/UniProt/A9KX19/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9KX19",
        "id": "MNME_SHEB9",
        "source_organism": {
            "taxId": "399599",
            "scientificName": "Shewanella baltica (strain OS195)",
            "fullName": "Shewanella baltica (strain OS195)"
        },
        "name": "tRNA modification GTPase MnmE",
        "description": [
            "Exhibits a very high intrinsic GTPase hydrolysis rate. Involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34"
        ],
        "length": 453,
        "sequence": "MTTDTIVAQATAPGRGGVGIIRISGDKASDVAMAVLGHLPKTRYADYCDFKSASGQVIDQGIALFFKGPNSFTGEDVLELQGHGGQIVLDMLIKRVMEVGGIRIAKPGEFSEQAFMNDKLDLTQAEAIADLIDATSEQAAKSALQSLQGEFSKEVHELVDQVTNLRLYVEAAIDFPDEEVDFLSDGKIANALYKIIDKLDLVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAIVTEIAGTTRDVLREHIHLDGMPLHIIDTAGLRDTNDTVEQIGIERAWNEINSADRVLFMVDGTTTAAVDPHTIWPDFVDRLPSNLGVTVIRNKADLTGEDLMMTEEQGYSVYRISAKTGLGVEELKQHLKSLMGYQSNLEGGFIARRRHLEALELAAGHLQLGKEQLEVYLAGELLAEELRMCQLALSEITGRFTSDDLLGKIFSSFCIGK",
        "proteome": null,
        "gene": "mnmE",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006400",
                "name": "tRNA modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "164d696ab196da12f9a745cf3fc980c3859f858f",
        "counters": {
            "domain_architectures": 23848,
            "entries": 25,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "cdd": 2,
                "ssf": 2,
                "ncbifam": 3,
                "profile": 1,
                "hamap": 1,
                "pfam": 3,
                "panther": 1,
                "interpro": 9
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 23848
        }
    }
}