HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9KX19",
"id": "MNME_SHEB9",
"source_organism": {
"taxId": "399599",
"scientificName": "Shewanella baltica (strain OS195)",
"fullName": "Shewanella baltica (strain OS195)"
},
"name": "tRNA modification GTPase MnmE",
"description": [
"Exhibits a very high intrinsic GTPase hydrolysis rate. Involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34"
],
"length": 453,
"sequence": "MTTDTIVAQATAPGRGGVGIIRISGDKASDVAMAVLGHLPKTRYADYCDFKSASGQVIDQGIALFFKGPNSFTGEDVLELQGHGGQIVLDMLIKRVMEVGGIRIAKPGEFSEQAFMNDKLDLTQAEAIADLIDATSEQAAKSALQSLQGEFSKEVHELVDQVTNLRLYVEAAIDFPDEEVDFLSDGKIANALYKIIDKLDLVQASAKQGSIIREGMKVVIAGRPNAGKSSLLNALAGKESAIVTEIAGTTRDVLREHIHLDGMPLHIIDTAGLRDTNDTVEQIGIERAWNEINSADRVLFMVDGTTTAAVDPHTIWPDFVDRLPSNLGVTVIRNKADLTGEDLMMTEEQGYSVYRISAKTGLGVEELKQHLKSLMGYQSNLEGGFIARRRHLEALELAAGHLQLGKEQLEVYLAGELLAEELRMCQLALSEITGRFTSDDLLGKIFSSFCIGK",
"proteome": null,
"gene": "mnmE",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006400",
"name": "tRNA modification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "164d696ab196da12f9a745cf3fc980c3859f858f",
"counters": {
"domain_architectures": 23848,
"entries": 25,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"cdd": 2,
"ssf": 2,
"ncbifam": 3,
"profile": 1,
"hamap": 1,
"pfam": 3,
"panther": 1,
"interpro": 9
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 23848
}
}
}