General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9JL91",
        "id": "A9JL91_ASFPB",
        "source_organism": {
            "taxId": "443876",
            "scientificName": "African swine fever virus (isolate Pig/Benin/Ben 97-1/1997)",
            "fullName": "African swine fever virus (isolate Pig/Benin/Ben 97-1/1997) (ASFV)"
        },
        "name": "DNA-directed RNA polymerase RPB3-11 homolog",
        "description": [
            "Component of the DNA-directed RNA polymerase (RNAP) that catalyzes the transcription in the cytoplasm of viral DNA into RNA using the four ribonucleoside triphosphates as substrates"
        ],
        "length": 359,
        "sequence": "MEKIFQNVEIKPFLIDFSNPFIKNAAKRLFQLEEQLPLVPVNVVMDFKGISRAAVHGLSRVLQDEIPNYMLDIKPGGYKIEDSTDLFMTEQFIRNRINFIPIYAKNETLVFALRSLNNSCEVKTIYSRDLIQVAGPKLKYPIFNPTFEIGFLQPGKSLIIEDIYIKKGIGRKHAAFNLAVKTHFSHLDIEQYPTDKKEYMALSGYKQSSMTSDPRHHRLGLCFPAVPLPHINQAVRTYLKNACRIIIGRIQSIQKIYENFEEPQPELVLFSLDEEKTKAIITIKDETHTIGNLLKTCIYEMIPDISFVGYQCVPHKQEMVLTIIHKASQEDLITLLEKSIQNIIQTFQILEKNVDELIA",
        "proteome": null,
        "gene": "H359L",
        "go_terms": [
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "e2e7f27c250030e65bd917ac82f2882b3be8acde",
        "counters": {
            "domain_architectures": 9452,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9452
        }
    }
}