General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9ITK8",
        "id": "A9ITK8_BORPD",
        "source_organism": {
            "taxId": "340100",
            "scientificName": "Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448 / CIP 107267 / Se-1111R)",
            "fullName": "Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448 / CIP 107267 / Se-1111R)"
        },
        "name": "Ubiquinone biosynthesis protein UbiV",
        "description": [
            "Required for O(2)-independent ubiquinone (coenzyme Q) biosynthesis. Together with UbiU, is essential for the C6-hydroxylation reaction in the oxygen-independent ubiquinone biosynthesis pathway"
        ],
        "length": 294,
        "sequence": "MPYQISLGPLLYYWPRRTVLDFYAAAIDSPVDIVYIGETVCSRRHEMRAADWLDLARALRDAGKTVVLSSQTLIETSADAHALRRLCDNDDFLLEAGEIGALRHLKGRQFVAGPHINAYHGDTLAWLATQGAMRVVVPVELDRDTLRALLQERPTGLQAEVMVWGRLPLAFSARCFTARHFRLKKDACEFRCIEYPDGLPVQTREGQPFLAFNGIQTQSAACLDLLDQAGELAAMGVEVLRVSPQSQNTLQAVAALDQIRRGLPLQPVAPPEGIDRCNGYWHGRAGIDYLENLS",
        "proteome": "UP000001225",
        "gene": "ubiV",
        "go_terms": [
            {
                "identifier": "GO:0006744",
                "name": "ubiquinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "af1224ccfbd87cb9de4cdb37bb468db0e250e588",
        "counters": {
            "domain_architectures": 14385,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14385
        }
    }
}