GET /api/protein/UniProt/A9BG78/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9BG78",
        "id": "SECF_PETMO",
        "source_organism": {
            "taxId": "403833",
            "scientificName": "Petrotoga mobilis (strain DSM 10674 / SJ95)",
            "fullName": "Petrotoga mobilis (strain DSM 10674 / SJ95)"
        },
        "name": "Protein translocase subunit SecF",
        "description": [
            "Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. SecDF uses the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA"
        ],
        "length": 302,
        "sequence": "MPNIDFVGKRSFFIYLSIALILFSVIVIFVKGFNLGVDFSGGSEIIVSFDKSYTIDELRNGLQTINQEYATAKIIQTNPGGGASDQFFYIITVRDSFPTLEEKQMFINSLEESFSDSSLNIEQFNDVSGYAAREIRSYAWYAVIISLIVLLAYITIRFQFSYGVGAILALAHDVIITLGFYSLFGIEMNLTAIAAFLTLAGYSLNDTIVVYDRIRENRSKNRGMDIESITNKSINEVIVRSLNTSLTTFLVVFMMFLLGGRSIASFAFGLTVGVIIGTYSSLYIASPIVIGMVKRRKKTQKA",
        "proteome": "UP000000789",
        "gene": "secF",
        "go_terms": [
            {
                "identifier": "GO:0015450",
                "name": "protein-transporting ATPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fb198d10d82866362b9e10811f0ba538abb3baa8",
        "counters": {
            "domain_architectures": 16473,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16473
        }
    }
}