GET /api/protein/UniProt/A9BG78/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9BG78",
"id": "SECF_PETMO",
"source_organism": {
"taxId": "403833",
"scientificName": "Petrotoga mobilis (strain DSM 10674 / SJ95)",
"fullName": "Petrotoga mobilis (strain DSM 10674 / SJ95)"
},
"name": "Protein translocase subunit SecF",
"description": [
"Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. SecDF uses the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA"
],
"length": 302,
"sequence": "MPNIDFVGKRSFFIYLSIALILFSVIVIFVKGFNLGVDFSGGSEIIVSFDKSYTIDELRNGLQTINQEYATAKIIQTNPGGGASDQFFYIITVRDSFPTLEEKQMFINSLEESFSDSSLNIEQFNDVSGYAAREIRSYAWYAVIISLIVLLAYITIRFQFSYGVGAILALAHDVIITLGFYSLFGIEMNLTAIAAFLTLAGYSLNDTIVVYDRIRENRSKNRGMDIESITNKSINEVIVRSLNTSLTTFLVVFMMFLLGGRSIASFAFGLTVGVIIGTYSSLYIASPIVIGMVKRRKKTQKA",
"proteome": "UP000000789",
"gene": "secF",
"go_terms": [
{
"identifier": "GO:0015450",
"name": "protein-transporting ATPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006886",
"name": "intracellular protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fb198d10d82866362b9e10811f0ba538abb3baa8",
"counters": {
"domain_architectures": 16473,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 16473
}
}
}