GET /api/protein/UniProt/A9B9D0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9B9D0",
"id": "A9B9D0_PROM4",
"source_organism": {
"taxId": "93059",
"scientificName": "Prochlorococcus marinus (strain MIT 9211)",
"fullName": "Prochlorococcus marinus (strain MIT 9211)"
},
"name": "Peptide deformylase",
"description": [
"Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions"
],
"length": 201,
"sequence": "MARSFAQLAKNAEKGSNSIAVSKEPTEKPSLKIHTLGNLELRQTAQRVSKVDNSIRTLIKKMLHSMYSAKGIGLAAPQVGIHKQLLVIDLDIENSTTPPIVLINPQITDFSAAIETYEEGCLSIPGVYLNVIRPSSIKLNFRDEMGRPKKMNADGLLSRCIQHEMDHLNGVLFVDRVTNENDLSKELQEHGFNSEDVISII",
"proteome": "UP000000788",
"gene": "def",
"go_terms": [
{
"identifier": "GO:0042586",
"name": "peptide deformylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fa547ef24adbcac0a50b8b949cdd967c1ce8b23b",
"counters": {
"domain_architectures": 45842,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 45842
}
}
}