HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9A799",
"id": "ADHS_METM6",
"source_organism": {
"taxId": "444158",
"scientificName": "Methanococcus maripaludis (strain C6 / ATCC BAA-1332)",
"fullName": "Methanococcus maripaludis (strain C6 / ATCC BAA-1332)"
},
"name": "2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase",
"description": [
"Catalyzes a transaldol reaction between 6-deoxy-5-ketofructose 1-phosphate (DKFP) and L-aspartate semialdehyde (ASA) with an elimination of hydroxypyruvaldehyde phosphate to yield 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate (ADH). Plays a key role in an alternative pathway of the biosynthesis of 3-dehydroquinate (DHQ), which is involved in the canonical pathway for the biosynthesis of aromatic amino acids"
],
"length": 272,
"sequence": "MKMFDNIKNVGKLIRLERIFDKNSEKTVIIPMDHGVSSGPLDGIKDMRITTNAVADGGANAVLGHKGLVRHGHRGYGRDIGLIIHMSAGTSISPDPNKKVIVTTVEDAIRLGADAVSLHVNVGAETDFEMYRDLGLISETCEQWGMPLIAMMYPRGPKIKDEKDPEVVAHAARLGAELGADIIKTNYTGDPDTFKEVVKGCPAPIVIAGGPKTNTDEEFLQMVKDAMHAGGKGVASGRNVFQHKDVKGITRAICKIVHEDVEVKEALKEIKI",
"proteome": null,
"gene": "aroA'",
"go_terms": [
{
"identifier": "GO:0016829",
"name": "lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004332",
"name": "fructose-bisphosphate aldolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016836",
"name": "hydro-lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009073",
"name": "aromatic amino acid family biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eef5f42e892995aae7b9ad95dbe411ff3160f897",
"counters": {
"domain_architectures": 38504,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"smart": 1,
"cdd": 1,
"pirsf": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 38504
}
}
}