GET /api/protein/UniProt/A8SE14/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8SE14",
        "id": "A8SE14_9FIRM",
        "source_organism": {
            "taxId": "411485",
            "scientificName": "Faecalibacterium prausnitzii M21/2",
            "fullName": "Faecalibacterium prausnitzii M21/2"
        },
        "name": "3-oxoacyl-[acyl-carrier-protein] synthase 2",
        "description": [
            "Involved in the type II fatty acid elongation cycle. Catalyzes the elongation of a wide range of acyl-ACP by the addition of two carbons from malonyl-ACP to an acyl acceptor. Can efficiently catalyze the conversion of palmitoleoyl-ACP (cis-hexadec-9-enoyl-ACP) to cis-vaccenoyl-ACP (cis-octadec-11-enoyl-ACP), an essential step in the thermal regulation of fatty acid composition"
        ],
        "length": 412,
        "sequence": "MEKRRVVITGLGTVNPLGNNVADSWAAARAGKCGIGPITQFDTTDFKCKLAGEVKDFDPETVVDKKEVRKMARFTLLALGAAAEAIADSGLDTEAEGKDIGVILSSGIGGLPTIEEQHARGEEKGMEKVSPYFVPMAIANMAAAQVAIRFGLKGMCTCPVTACAGGTNAVGDAFHRIRDGYEPVMVCGGAESCISPLGIGGFTSMKALSTATDPDAASLPFDARRGGFVMGEGSGVLVLEELEHARARGAHIYAEVVGYGANCDAYHFTAPAPGGAGAIDCMKLTLVDADIAPEQVDHINAHGTGTHMNDACETAAIHAVFGAHAKEMTVVSTKSMTGHLLGGAGGIEAVFTALALRDQFAPPTIHYAQPDPECDLDYVPNTGRQQEMQYALSNSLGFGGHNACIALRRWEG",
        "proteome": null,
        "gene": "fabF",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016747",
                "name": "acyltransferase activity, transferring groups other than amino-acyl groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "63eb6792a9342ab83cd3a375e7ae8f30645ac2dc",
        "counters": {
            "domain_architectures": 74536,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 2,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 74536
        }
    }
}