HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A8SE14",
"id": "A8SE14_9FIRM",
"source_organism": {
"taxId": "411485",
"scientificName": "Faecalibacterium prausnitzii M21/2",
"fullName": "Faecalibacterium prausnitzii M21/2"
},
"name": "3-oxoacyl-[acyl-carrier-protein] synthase 2",
"description": [
"Involved in the type II fatty acid elongation cycle. Catalyzes the elongation of a wide range of acyl-ACP by the addition of two carbons from malonyl-ACP to an acyl acceptor. Can efficiently catalyze the conversion of palmitoleoyl-ACP (cis-hexadec-9-enoyl-ACP) to cis-vaccenoyl-ACP (cis-octadec-11-enoyl-ACP), an essential step in the thermal regulation of fatty acid composition"
],
"length": 412,
"sequence": "MEKRRVVITGLGTVNPLGNNVADSWAAARAGKCGIGPITQFDTTDFKCKLAGEVKDFDPETVVDKKEVRKMARFTLLALGAAAEAIADSGLDTEAEGKDIGVILSSGIGGLPTIEEQHARGEEKGMEKVSPYFVPMAIANMAAAQVAIRFGLKGMCTCPVTACAGGTNAVGDAFHRIRDGYEPVMVCGGAESCISPLGIGGFTSMKALSTATDPDAASLPFDARRGGFVMGEGSGVLVLEELEHARARGAHIYAEVVGYGANCDAYHFTAPAPGGAGAIDCMKLTLVDADIAPEQVDHINAHGTGTHMNDACETAAIHAVFGAHAKEMTVVSTKSMTGHLLGGAGGIEAVFTALALRDQFAPPTIHYAQPDPECDLDYVPNTGRQQEMQYALSNSLGFGGHNACIALRRWEG",
"proteome": null,
"gene": "fabF",
"go_terms": [
{
"identifier": "GO:0016746",
"name": "acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016747",
"name": "acyltransferase activity, transferring groups other than amino-acyl groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006633",
"name": "fatty acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "63eb6792a9342ab83cd3a375e7ae8f30645ac2dc",
"counters": {
"domain_architectures": 74536,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"pfam": 2,
"ssf": 1,
"cdd": 1,
"smart": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 74536
}
}
}