HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A8R7X5",
"id": "A8R7X5_9FIRM",
"source_organism": {
"taxId": "428127",
"scientificName": "Amedibacillus dolichus DSM 3991",
"fullName": "Amedibacillus dolichus DSM 3991"
},
"name": "Tryptophan--tRNA ligase",
"description": [
"Catalyzes the attachment of tryptophan to tRNA(Trp)"
],
"length": 328,
"sequence": "MKRMLSGIKPTGRLTLGNYIGAIRNFVAYQEDYDMYVFIANLHAITVPIERAELKQNTKDLIALYLACGLDPKKATIFLQSDLHEHAELGWILTCNSYVGELQRMTQYKDKTAKGETGITAGLFTYPSLMAADILLYDADYVPVGVDQKQHVELTRDLAERFNHRYGDTFTVPEPLVAKVGAKVYSLQDPRKKMSKSEDNPKGTIDLLDEPSVARKKIMSAVTDSIGIIQYDPEQQPGISNLLTILSSLNNETIEDIVARYAGKGYGEFKKEVGECVYQFLTQLQSKYKEIIASGMVEKVITEGNDKARQIAHKKIMKVKKKVGFQLF",
"proteome": null,
"gene": "trpS",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004830",
"name": "tryptophan-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006436",
"name": "tryptophanyl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eec45b89b85171af552391185649fe58227bbbee",
"counters": {
"domain_architectures": 50358,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 2,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 50358
}
}
}