GET /api/protein/UniProt/A8R171/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A8R171",
"id": "A8R171_9CHRO",
"source_organism": {
"taxId": "449451",
"scientificName": "Microcystis wesenbergii NIES-105",
"fullName": "Microcystis wesenbergii NIES-105"
},
"name": "glutamine synthetase",
"description": [
"Involved in nitrogen metabolism via ammonium assimilation. Catalyzes the ATP-dependent biosynthesis of glutamine from glutamate and ammonia"
],
"length": 150,
"sequence": "SIKEPRTGEWYSRDPRSIAQKAIDYLSTTGLGDTVYFGPEAEFFLFDSARFDQTANSGYYYMDSVEGRWNSGKDEKDGNLAYKPAYKQGYFPVSPTDTSQDIRTEMLLTMADCGVPIEKHHHEVATGGQNELGIKFSTLVRAADYLMTYK",
"proteome": null,
"gene": "glnA",
"go_terms": [
{
"identifier": "GO:0004356",
"name": "glutamine synthetase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "163010077a11b971d09a08ee20f48bfa4a0ae17e",
"counters": {
"domain_architectures": 33438,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"ssf": 1,
"pfam": 1,
"cathgene3d": 1,
"profile": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 33438
}
}
}