GET /api/protein/UniProt/A8R171/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8R171",
        "id": "A8R171_9CHRO",
        "source_organism": {
            "taxId": "449451",
            "scientificName": "Microcystis wesenbergii NIES-105",
            "fullName": "Microcystis wesenbergii NIES-105"
        },
        "name": "glutamine synthetase",
        "description": [
            "Involved in nitrogen metabolism via ammonium assimilation. Catalyzes the ATP-dependent biosynthesis of glutamine from glutamate and ammonia"
        ],
        "length": 150,
        "sequence": "SIKEPRTGEWYSRDPRSIAQKAIDYLSTTGLGDTVYFGPEAEFFLFDSARFDQTANSGYYYMDSVEGRWNSGKDEKDGNLAYKPAYKQGYFPVSPTDTSQDIRTEMLLTMADCGVPIEKHHHEVATGGQNELGIKFSTLVRAADYLMTYK",
        "proteome": null,
        "gene": "glnA",
        "go_terms": [
            {
                "identifier": "GO:0004356",
                "name": "glutamine synthetase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "163010077a11b971d09a08ee20f48bfa4a0ae17e",
        "counters": {
            "domain_architectures": 33438,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 33438
        }
    }
}