GET /api/protein/UniProt/A8I2E0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A8I2E0",
"id": "A8I2E0_CHLRE",
"source_organism": {
"taxId": "3055",
"scientificName": "Chlamydomonas reinhardtii",
"fullName": "Chlamydomonas reinhardtii"
},
"name": "Superoxide dismutase",
"description": [
"Destroys radicals which are normally produced within the cells and which are toxic to biological systems"
],
"length": 218,
"sequence": "MAQALPPLPYDYGSLEPHVDATTMNIHHTKHHQTYVNNLNAALDKFPELKDLGLVDLNKAVGTDKLPKDVATVIRNNGGGHYNHSFFWKVMTNPSNTNGPNGDVKAAIEASFGSVDEMKAKFNAAAAGRFGSGWAWLSVKPDGSLSIDSTPNQDNPLMTALPDVAGGIPLLGLDVWEHAYYLKYQNRRPEYIAAWWNVVNWEQVAENYKAAQAGTVPL",
"proteome": "UP000006906",
"gene": "MSD1",
"go_terms": [
{
"identifier": "GO:0004784",
"name": "superoxide dismutase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006801",
"name": "superoxide metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fd6207aea5eb2a91ae628a69adfab9df8e89ed4f",
"counters": {
"domain_architectures": 39182,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"pfam": 2,
"cathgene3d": 2,
"pirsf": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 39182
}
}
}