GET /api/protein/UniProt/A8H5B1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8H5B1",
        "id": "A8H5B1_SHEPA",
        "source_organism": {
            "taxId": "398579",
            "scientificName": "Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)",
            "fullName": "Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)"
        },
        "name": "Chaperone NapD",
        "description": [
            "Chaperone for NapA, the catalytic subunit of the periplasmic nitrate reductase. It binds directly and specifically to the twin-arginine signal peptide of NapA, preventing premature interaction with the Tat translocase and premature export"
        ],
        "length": 85,
        "sequence": "MSNELHVTSLVLQVQPEQMSAVRQTIIEMENAELSVNNEVKLVVVLEGNSQKSLMTSIETINAIPGVLSAAMVYHQSEVLEEGEQ",
        "proteome": "UP000002608",
        "gene": "napD",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cf776605ff36c65548fdc5ce6bdd33b93d45d007",
        "counters": {
            "domain_architectures": 3139,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3139
        }
    }
}