General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8G9T9",
        "id": "ZAPD_SERP5",
        "source_organism": {
            "taxId": "399741",
            "scientificName": "Serratia proteamaculans (strain 568)",
            "fullName": "Serratia proteamaculans (strain 568)"
        },
        "name": "Cell division protein ZapD",
        "description": [
            "Cell division factor that enhances FtsZ-ring assembly. Directly interacts with FtsZ and promotes bundling of FtsZ protofilaments, with a reduction in FtsZ GTPase activity"
        ],
        "length": 250,
        "sequence": "MSDVSPSVLFEHPLNEKMRTWLRMEFLLQQLHGQRALSETAIALTFFRTVADLLDVLERGEVRTELLKELERQQQKLLAWADVPGVDMSLVDQLRNQLKQRGAALMSAPRLGQSLREDRLISLVRQRLSIPGGCCSFDLPTLHMWMHAPQQERDDDVANWQQTLEPLNQALTMVLDLIRQSGQFRNQISLNGFFQDNAEGADLLRLRINLAHQLYPQISGHKTRYAIRFLPLDSELGVVPERLTFELACC",
        "proteome": null,
        "gene": "zapD",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dbee6872279ab957762788d6329129bfc1d1b719",
        "counters": {
            "domain_architectures": 3897,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3897
        }
    }
}