General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8FY31",
        "id": "FABZ_SHESH",
        "source_organism": {
            "taxId": "425104",
            "scientificName": "Shewanella sediminis (strain HAW-EB3)",
            "fullName": "Shewanella sediminis (strain HAW-EB3)"
        },
        "name": "3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ",
        "description": [
            "Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs"
        ],
        "length": 153,
        "sequence": "MSNQLNTMDIKEIMNSLPHRYPFLLIDRVLDYTPGETLHAIKNVTINEPFFQGHFPIQPVMPGVLILEAMAQATGLLAYKTMEAAVTDDSLYYFAGIDKARFKRVVEPGDQLHFEVKMVKERRGIGVFTGVVKVDGELVCSAEIMCARREIKK",
        "proteome": "UP000002015",
        "gene": "fabZ",
        "go_terms": [
            {
                "identifier": "GO:0016836",
                "name": "hydro-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6eee872930b0f833d0a363bc10e4597494e29e33",
        "counters": {
            "domain_architectures": 27313,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 27313
        }
    }
}