GET /api/protein/UniProt/A8FG00/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8FG00",
        "id": "A8FG00_BACP2",
        "source_organism": {
            "taxId": "315750",
            "scientificName": "Bacillus pumilus (strain SAFR-032)",
            "fullName": "Bacillus pumilus (strain SAFR-032)"
        },
        "name": "Aspartokinase",
        "description": [
            "Catalyzes the phosphorylation of the beta-carboxyl group of aspartic acid with ATP to yield 4-phospho-L-aspartate, which is involved in the branched biosynthetic pathway leading to the biosynthesis of amino acids threonine, isoleucine and methionine"
        ],
        "length": 409,
        "sequence": "MGLIVQKFGGTSVGSTEKIRNAAERVIAERKAGHDVVVVVSAMGKSTDVLVDLAKELTDHPSNREMDMLLATGEQVTISLLTMALQAKGYDAISFTGWQAGMKTEQVHGNARIVDIDESRVKEELNAGKVVVVAGFQGIADDLHITTLGRGGSDTTAVALAAALKADKCDIYTDVPGVFTTDPRYVPAARKLAGISYDEMLELANLGAGVLHPRAVEFAKNYQVPLEVRSSIENESGTLIEEESSMEQNLVVRGIAFEDQITRVTVCGLSSGLTTLSTIFTTLAKQNINVDIIIQSVTSTNQTSISFSVKTDDLSKTVEVLEEYKGALGYEQIETESKLAKVSIVGSGMVSNPGVAAEMFAVLAEKDIQVKMVSTSEIKVSTVVGRDDMVKAVEALHDAFDLSKVAAHS",
        "proteome": "UP000001355",
        "gene": "BPUM_2505",
        "go_terms": [
            {
                "identifier": "GO:0004072",
                "name": "aspartate kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008652",
                "name": "amino acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009089",
                "name": "L-lysine biosynthetic process via diaminopimelate",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dbd4045e309185800891689d2a7a6f4a298ac6c7",
        "counters": {
            "domain_architectures": 7894,
            "entries": 27,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 3,
                "ssf": 2,
                "profile": 1,
                "pfam": 2,
                "ncbifam": 5,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7894
        }
    }
}