General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8F961",
        "id": "CYSE_BACP2",
        "source_organism": {
            "taxId": "315750",
            "scientificName": "Bacillus pumilus (strain SAFR-032)",
            "fullName": "Bacillus pumilus (strain SAFR-032)"
        },
        "name": "Serine acetyltransferase",
        "description": [
            "Catalyzes the acetylation of serine by acetyl-CoA to produce O-acetylserine (OAS)"
        ],
        "length": 217,
        "sequence": "MFFKMLKEDIDTVFDQDPAARSYIEVVLTYSGLHAIWAHRIAHAFYKRKLYFLARIISQVSRFFTGVEIHPAATIGRRFFIDHGMGVVIGETCEIGDNVTVFQGVTLGGTGKEKGKRHPTILDDALIATGAKVLGSITVGKGAKIGAGSVVLKDVPDHSTVVGIPGRVVVQNGKKINRDLNHQDLPDPISDRFKELEREMEKLKGELASLSRKEEQS",
        "proteome": "UP000001355",
        "gene": "cysE",
        "go_terms": [
            {
                "identifier": "GO:0009001",
                "name": "serine O-acetyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006535",
                "name": "L-cysteine biosynthetic process from L-serine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f25e9e91aa8269ba84b9d4e0ae53d94cf61bce83",
        "counters": {
            "domain_architectures": 7922,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7922
        }
    }
}