GET /api/protein/UniProt/A7ZT06/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A7ZT06",
"id": "TUSA_ECO24",
"source_organism": {
"taxId": "331111",
"scientificName": "Escherichia coli O139:H28 (strain E24377A / ETEC)",
"fullName": "Escherichia coli O139:H28 (strain E24377A / ETEC)"
},
"name": "Sulfur carrier protein TusA",
"description": [
"Sulfur carrier protein involved in sulfur trafficking in the cell. Part of a sulfur-relay system required for 2-thiolation during synthesis of 2-thiouridine of the modified wobble base 5-methylaminomethyl-2-thiouridine (mnm(5)s(2)U) in tRNA. Interacts with IscS and stimulates its cysteine desulfurase activity. Accepts an activated sulfur from IscS, which is then transferred to TusD, and thus determines the direction of sulfur flow from IscS to 2-thiouridine formation. Also appears to be involved in sulfur transfer for the biosynthesis of molybdopterin"
],
"length": 81,
"sequence": "MTDLFSSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFMEHELVAKETDGLPYRYLIRKGG",
"proteome": "UP000001122",
"gene": "tusA",
"go_terms": [
{
"identifier": "GO:0097163",
"name": "sulfur carrier activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0002143",
"name": "tRNA wobble position uridine thiolation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "be88bee338af40a52f33520c9062dad4cf0cb53e",
"counters": {
"domain_architectures": 20829,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 20829
}
}
}