General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7Z695",
        "id": "A7Z695_BACVZ",
        "source_organism": {
            "taxId": "326423",
            "scientificName": "Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)",
            "fullName": "Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)"
        },
        "name": "Purine nucleoside phosphorylase",
        "description": [
            "The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta-(deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate. Cleaves guanosine, inosine, 2'-deoxyguanosine and 2'-deoxyinosine"
        ],
        "length": 272,
        "sequence": "MKQKIERAAAFIKEHVKETPKIGLILGSGLGVLADEIEGAVKLTYETIPDFPVSTVEGHAGQLVMGTLEGVQVIAMQGRFHYYEGYSMDQVTFPVRVMKALGVESLVVTNAAGGINTEFRAGDLMIITDHINFTGTNPLIGPNEAEFGPRFPDMSEAYDKELSGLAEKTADELGIPVQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILDQPLSHEEVMEMTEKVKGGFLKLVKAVVARSQK",
        "proteome": "UP000001120",
        "gene": "RBAM_021600",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009116",
                "name": "nucleoside metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004731",
                "name": "purine-nucleoside phosphorylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006139",
                "name": "nucleobase-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016763",
                "name": "pentosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "27552274e8941821ae0d138350daef5fe3adde72",
        "counters": {
            "domain_architectures": 85785,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "pirsf": 1,
                "ncbifam": 3,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 85785
        }
    }
}