General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7UVN1",
        "id": "WUHO_ANOGA",
        "source_organism": {
            "taxId": "7165",
            "scientificName": "Anopheles gambiae",
            "fullName": "Anopheles gambiae (African malaria mosquito)"
        },
        "name": "tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho",
        "description": [
            "Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational changes of the catalytic subunit"
        ],
        "length": 382,
        "sequence": "MYDLKIYSSYIVAAIKDKIVFFSTDGAVLHTITVEQKAPVKDTDAGNEPNGNQTQPTPANVVTFEYCPTAKVLAVSLSDKTWRRYQLREEDGGKLCSAPLGEDITTARTIVSMKFVPKHGVLFGTDKSDCFEFGALDKTSEPQPKWILGHMSQILALAVSDDERFIVTSDRDEKIKVSSYPDCHNIECFCLGHTEYVGGIEIIPSEKLISVSGDRTLRLWDVTEGKELSKLSLKEPALDFTVQKVAEGCGMLCAVRSYVQNMVEVALVSYDKPDASELYDPLTIDESLIILNAGLSASLRLMLLTMEKESKRVRMLVYEFCAEKRAFKACDDHPFVKNFEDQFKDVTIEQVRDYSTLFKHTIDNLTEYFERKKIKMESKKSK",
        "proteome": "UP000007062",
        "gene": "wuho",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0036265",
                "name": "RNA (guanine-N7)-methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "35c3a2b802fd9ab75d4e0df5220beffd6dca46af",
        "counters": {
            "domain_architectures": 93161,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "profile": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 93161
        }
    }
}