GET /api/protein/UniProt/A7SP86/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7SP86",
        "id": "A7SP86_NEMVE",
        "source_organism": {
            "taxId": "45351",
            "scientificName": "Nematostella vectensis",
            "fullName": "Nematostella vectensis (Starlet sea anemone)"
        },
        "name": "Translocon-associated protein subunit delta",
        "description": [
            "TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins"
        ],
        "length": 171,
        "sequence": "MAVAKFFVGFIGLLVPLLASGEPCVGPKATSTSYTSTNIFMSSETVFLTEFSLACDNNAKDVSLYAEVNGKVMPVTRSTDNSKYQVSWSEEHKQAKSGVYTINFLDEEGYSNYRKAQRSGGSLDIKPLFTIDINHKGAGREGLWVQTEFIAVVAALLIWWCANNVKSKLQE",
        "proteome": "UP000001593",
        "gene": "NEMVEDRAFT_v1g237405",
        "go_terms": [
            {
                "identifier": "GO:0005783",
                "name": "endoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15f3a86d8e50f1a171be056fd9f62a6aeb059501",
        "counters": {
            "domain_architectures": 1436,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1436
        }
    }
}