GET /api/protein/UniProt/A7MZH4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A7MZH4",
"id": "RLME_VIBC1",
"source_organism": {
"taxId": "2902295",
"scientificName": "Vibrio campbellii (strain ATCC BAA-1116)",
"fullName": "Vibrio campbellii (strain ATCC BAA-1116)"
},
"name": "Ribosomal RNA large subunit methyltransferase E",
"description": [
"Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit"
],
"length": 209,
"sequence": "MSKQKHSASSGRWLKEHFDDKYANEARKKGYRSRAYFKIEEIQTKDKLLKSGMTVVDLGAAPGGWSQYAAKIIGEEGQIIACDLLPMDPIAGVSFLQGDFRDEAVLDALLERIQPSMVDVVMSDMAPNIAGNNSVDQPRAMYLVELALDMCRQVLAPNGSFVVKVFQGEGFDQFVKEVRDMFKVVKIRKPDSSRARSREVFVVATGYKG",
"proteome": null,
"gene": "rlmE",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0001510",
"name": "RNA methylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0032259",
"name": "methylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "71a5d42e748b06cd2d42035318a449fe592a7c1a",
"counters": {
"domain_architectures": 26600,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 26600
}
}
}