General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7MPP2",
        "id": "A7MPP2_CROS8",
        "source_organism": {
            "taxId": "290339",
            "scientificName": "Cronobacter sakazakii (strain ATCC BAA-894)",
            "fullName": "Cronobacter sakazakii (strain ATCC BAA-894)"
        },
        "name": "Diacylglycerol kinase",
        "description": [
            "Catalyzes the ATP-dependent phosphorylation of sn-l,2-diacylglycerol (DAG) to phosphatidic acid. Involved in the recycling of diacylglycerol produced as a by-product during membrane-derived oligosaccharide (MDO) biosynthesis"
        ],
        "length": 122,
        "sequence": "MANNTTGLTRIINAAGYSWKGLRAAWKNEAAFRQEGVAVIAAILIACWLDVDPITRVLLIGSVTLVMIVEILNSAIEAVVDRIGPEFHELSGRAKDMGSAAVLLSIILALVVWVTLLWQHLR",
        "proteome": "UP000000260",
        "gene": "ESA_00088",
        "go_terms": [
            {
                "identifier": "GO:0016301",
                "name": "kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008610",
                "name": "lipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004143",
                "name": "ATP-dependent diacylglycerol kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006654",
                "name": "phosphatidic acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008654",
                "name": "phospholipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f031673be3b69fae3e2cf83b816f8698a9f4a920",
        "counters": {
            "domain_architectures": 15235,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15235
        }
    }
}