General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7MIE2",
        "id": "A7MIE2_CROS8",
        "source_organism": {
            "taxId": "290339",
            "scientificName": "Cronobacter sakazakii (strain ATCC BAA-894)",
            "fullName": "Cronobacter sakazakii (strain ATCC BAA-894)"
        },
        "name": "Transcriptional regulator MraZ",
        "description": [
            "Negatively regulates its own expression and that of the subsequent genes in the proximal part of the division and cell wall (dcw) gene cluster. Acts by binding directly to DNA. May also regulate the expression of genes outside the dcw cluster"
        ],
        "length": 152,
        "sequence": "MFRGATLVNLDSKGRLSVPTRYRDLLNDASSGQMVCTIDIHHPCLLLYTLPEWVIIEQKLSRLSSMNPAERRVQRLLLGHASECQMDSAGRLLLAPVLRQHAGLTKQVMLVGQFNKFELWDEATWHQQVREDIDAEQSSSEVLSERLQDLSL",
        "proteome": "UP000000260",
        "gene": "mraZ",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c69104d98f7b4177b1bdbe65a238838f3816e5cb",
        "counters": {
            "domain_architectures": 17395,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 2,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17395
        }
    }
}