General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7KGH2",
        "id": "A7KGH2_9CYAN",
        "source_organism": {
            "taxId": "197229",
            "scientificName": "Limnoraphis robusta CCAP 1446/4",
            "fullName": "Limnoraphis robusta CCAP 1446/4"
        },
        "name": "nitrogenase",
        "description": [
            "The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein"
        ],
        "length": 108,
        "sequence": "STRLILNCKAQVTVLHLAAERGSVEDIELEDVLLEGFEGIKCVESGGPEPGVGCAGCGIITSINFLEEAGAYVDLDFVSYDVLGDVVCGGFAMPIREGKAQEIYIVTS",
        "proteome": null,
        "gene": "nifH",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "071df9b5c0283bbb9290ef29639d54eb5a20356f",
        "counters": {
            "domain_architectures": 24594,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 24594
        }
    }
}