General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A7B2K3",
        "id": "A7B2K3_MEDG7",
        "source_organism": {
            "taxId": "411470",
            "scientificName": "Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)",
            "fullName": "Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9)"
        },
        "name": "ATP synthase subunit delta",
        "description": [
            "This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction",
            "F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation"
        ],
        "length": 162,
        "sequence": "MRYAQVLYELNVPKEAIQKAREIFEEVPQLHDVFVNPTIPAQKKERVIDKVFPQEMRNFLKVACKYERMDLIPEIFAAYDRYCDEQDRILSAVLTCVELPSDEQLKNMEAFLCKKYEASKARIEIQTDSTLLGGFVLRTGSDEYDWSLKGRLDRLGQKLTWR",
        "proteome": null,
        "gene": "atpH",
        "go_terms": [
            {
                "identifier": "GO:0046933",
                "name": "proton-transporting ATP synthase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015986",
                "name": "proton motive force-driven ATP synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "84bdeca744b3566e5527e453190da923dfa0eb71",
        "counters": {
            "domain_architectures": 30348,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 30348
        }
    }
}