General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6ZV63",
        "id": "SLX9_YEAS7",
        "source_organism": {
            "taxId": "307796",
            "scientificName": "Saccharomyces cerevisiae (strain YJM789)",
            "fullName": "Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)"
        },
        "name": "Ribosome biogenesis protein SLX9",
        "description": [
            "Involved in ribosome biogenesis. Required for normal pre-rRNA processing in internal transcribed spacer 1 (ITS1). May be involved in the movements of the replication forks (By similarity)"
        ],
        "length": 210,
        "sequence": "MVAKKRNTLRSKASARNSQNFGPDVANNGILDESYDIESDPRAFLHQPKETKKEKLLNRQNTFLSNLKGKSTLSDGIGANFDGISKSSIRRRKRKLREELKPRMQDLLTSLEQEKDLRGIIENSSKDMNNDDDIDMDSKIRFVDTKEMNLKKIEPGSVRIKKNQPNIRNQKGAKALAANETARFNQVLTNQDFQKNPFGALREVIKLQKH",
        "proteome": null,
        "gene": "SLX9",
        "go_terms": [
            {
                "identifier": "GO:0000462",
                "name": "maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005730",
                "name": "nucleolus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030686",
                "name": "90S preribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030688",
                "name": "preribosome, small subunit precursor",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3b329d3e77566ece8b98fecf1c4b978fed6a510e",
        "counters": {
            "domain_architectures": 3535,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3535
        }
    }
}