GET /api/protein/UniProt/A6W3V2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "A6W3V2",
"id": "RNPA_MARMS",
"source_organism": {
"taxId": "400668",
"scientificName": "Marinomonas sp. (strain MWYL1)",
"fullName": "Marinomonas sp. (strain MWYL1)"
},
"name": "Ribonuclease P protein component",
"description": [
"RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme"
],
"length": 132,
"sequence": "MTEYCFPRHVRLLNAGDYQSVFNDTSSKVFAGEFLLLARKRDDDQTRLGLIVSKKTDKRAVGRNRIKRLVRDSFRHHKIPLSGLDIVFLARHGIKELENADLHNRLDKAWDQLAKKALKPTQNKKRDQSRQK",
"proteome": null,
"gene": "rnpA",
"go_terms": [
{
"identifier": "GO:0000049",
"name": "tRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004526",
"name": "ribonuclease P activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008033",
"name": "tRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c1c3f0c110430b6b6339279d367a29870e812f7d",
"counters": {
"domain_architectures": 24144,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 24144
}
}
}