HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A6VM31",
"id": "PYRH_ACTSZ",
"source_organism": {
"taxId": "339671",
"scientificName": "Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)",
"fullName": "Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)"
},
"name": "Uridylate kinase",
"description": [
"Catalyzes the reversible phosphorylation of UMP to UDP"
],
"length": 237,
"sequence": "MSNPIYKRILLKLSGEALQGAEGFGIDPSILDRMALEIKELIAMGVEVGVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVIFSGGTGSPFFTTDSAACLRGIEIEADVVLKATKVDGVYNCDPAKNPGAELFNTLTYADVIERELKVMDLAAFTLARDHGMPIRVFNMGKPGALREVVTGLTEGTIIS",
"proteome": "UP000001114",
"gene": "pyrH",
"go_terms": [
{
"identifier": "GO:0033862",
"name": "UMP kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006221",
"name": "pyrimidine nucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b73790bda6cd15191430dc28c4ec048bb434309a",
"counters": {
"domain_architectures": 77738,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 77738
}
}
}