General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6VCE4",
        "id": "MSRQ_PSEP7",
        "source_organism": {
            "taxId": "381754",
            "scientificName": "Pseudomonas paraeruginosa (strain DSM 24068 / PA7)",
            "fullName": "Pseudomonas paraeruginosa (strain DSM 24068 / PA7)"
        },
        "name": "Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ",
        "description": [
            "Part of the MsrPQ system that repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O), using respiratory chain electrons. Thus protects these proteins from oxidative-stress damage caused by reactive species of oxygen and chlorine generated by the host defense mechanisms. MsrPQ is essential for the maintenance of envelope integrity under bleach stress, rescuing a wide series of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, using the quinone pool of the respiratory chain"
        ],
        "length": 202,
        "sequence": "MRYWYLRLAVFLGALAMPAWWLYQAWIFALGPDPGKTLVDRLGLGALVLLLLTLAMTPLQKLSGWPGWIAVRRQLGLWCFTYALLHLSAYCVFILGLDWGQLGIELSKRPYIIVGMLGFICLFLLAITSNRFAMRKLGSRWKKLHRLVYLILGLGLLHMLWVVRADLEEWTLYAVVGASLMLLRLPSIARRLPRLRGRPGVS",
        "proteome": null,
        "gene": "msrQ",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b146733987e3df29591d4c1e917874cd598ab678",
        "counters": {
            "domain_architectures": 12998,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 12998
        }
    }
}