GET /api/protein/UniProt/A6U4B6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6U4B6",
        "id": "NART_STAA2",
        "source_organism": {
            "taxId": "359787",
            "scientificName": "Staphylococcus aureus (strain JH1)",
            "fullName": "Staphylococcus aureus (strain JH1)"
        },
        "name": "Probable nitrate transporter NarT",
        "description": [
            "Probably required for nitrate uptake under anoxic conditions. Also possibly involved in excretion of nitrite produced by the dissimilatory reduction of nitrate (By similarity)"
        ],
        "length": 389,
        "sequence": "MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLRVPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSVPKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIFGDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVDAGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALFTVGCLTISICAGIGNGLIFKLVPSYFSNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLAFIFLAVFGCIALFTMRHLYQKEYGSLKHS",
        "proteome": null,
        "gene": "narT",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015112",
                "name": "nitrate transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "04ed00d0ac42cc42b19f7796b389c797a27f88ba",
        "counters": {
            "domain_architectures": 1276664,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1276664
        }
    }
}