General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6QTM4",
        "id": "SHO1_AJECN",
        "source_organism": {
            "taxId": "2059318",
            "scientificName": "Ajellomyces capsulatus (strain NAm1 / WU24)",
            "fullName": "Ajellomyces capsulatus (strain NAm1 / WU24) (Darling's disease fungus)"
        },
        "name": "High osmolarity signaling protein SHO1",
        "description": [
            "Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity"
        ],
        "length": 292,
        "sequence": "MARMDFNNIVGDPFALIAWLLSFATCVISDIQGAFPNFAWWAVGYMLCAIIGISLVLASQTSHVYGVAIVGYLAAGLTFTTLAVNSLIYDDQASKQAGAAGFILQSMVTIVWIFYFGSSSQTSSRPYLDSMGAGKEHPSYRNSKPLSTNYGARPETVVSGNQPPQMYTSAQLNGFETSSPVSGYPPTAANGAENGTQNRFVGPAIGSQSNLGGGSTLGADHPSTPNEVSQPTVYPYRAKAIYSYEANPDDANEISFSKHEILDVSDVSGRWWQAKKASGETGIAPSNYLILI",
        "proteome": null,
        "gene": "SHO1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c13c3a27b8330049faa44ea9f819ca385dfc3c03",
        "counters": {
            "domain_architectures": 15993,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15993
        }
    }
}