GET /api/protein/UniProt/A6QIV1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6QIV1",
        "id": "ATPF_STAAE",
        "source_organism": {
            "taxId": "426430",
            "scientificName": "Staphylococcus aureus (strain Newman)",
            "fullName": "Staphylococcus aureus (strain Newman)"
        },
        "name": "ATP synthase subunit b",
        "description": [
            "F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation",
            "Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0)"
        ],
        "length": 173,
        "sequence": "MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK",
        "proteome": null,
        "gene": "atpF",
        "go_terms": [
            {
                "identifier": "GO:0015078",
                "name": "proton transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015986",
                "name": "proton motive force-driven ATP synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045259",
                "name": "proton-transporting ATP synthase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fa1ba68571565fd588f67ea2f853ca4d56800daf",
        "counters": {
            "domain_architectures": 44419,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 44419
        }
    }
}