GET /api/protein/UniProt/A6Q182/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6Q182",
        "id": "ILVD_NITSB",
        "source_organism": {
            "taxId": "387092",
            "scientificName": "Nitratiruptor sp. (strain SB155-2)",
            "fullName": "Nitratiruptor sp. (strain SB155-2)"
        },
        "name": "Dihydroxy-acid dehydratase",
        "description": [
            "Functions in the biosynthesis of branched-chain amino acids. Catalyzes the dehydration of (2R,3R)-2,3-dihydroxy-3-methylpentanoate (2,3-dihydroxy-3-methylvalerate) into 2-oxo-3-methylpentanoate (2-oxo-3-methylvalerate) and of (2R)-2,3-dihydroxy-3-methylbutanoate (2,3-dihydroxyisovalerate) into 2-oxo-3-methylbutanoate (2-oxoisovalerate), the penultimate precursor to L-isoleucine and L-valine, respectively"
        ],
        "length": 564,
        "sequence": "MRSDEIKKGFQRAPHRSLLRATGLKDEDFEKPFIGVANSFIEIIPGHFFLNKYAAIIKDEIRKCGCVPFEFNTIGVDDGIAMGHDGMLYSLPSREIIANSIETVMNAHKLDALICIPNCDKITPGMIMGALRVNVPTIFVSGGPMKAGKLSDGTPIDLATAFEAVGKVAKGEMSEEELYQIECEACPSGGSCSGMFTANSMNTLMEAMGIALKGNGTILALTPEREELLRKAARRICEIAKDEKLTQEYKIRNILNEKAIHNAFVVDMAMGGSTNTVLHMMAISKEAGVDFPLSKLNEISKHVAHIAKISPSLQTVHMEDINKAGGVSAVMKEASKRSDTVLYLDNPVIEGGTIGDRIKDAEVIDTSIIHPIDKPYSEVGGLAILFGNLAEEGAVVKTAGIDPNMREFTGKAICFDSQQEAIDGILGGKVKPGHVVVIRYEGPKGGPGMQEMLAPTSLIAGMNLGDKVALITDGRFSGATRGASIGHVSPEAAEGGVIGLLQDGDEIYINVDTYTLEVKLSDEELEERRKNFKPKVKDIKGRWLRQYRSLVTNAANGAVLKDEC",
        "proteome": null,
        "gene": "ilvD",
        "go_terms": [
            {
                "identifier": "GO:0004160",
                "name": "dihydroxy-acid dehydratase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009082",
                "name": "branched-chain amino acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "20dbcf2b42e05607c0e091533fa6941e21b50864",
        "counters": {
            "domain_architectures": 52946,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 52946
        }
    }
}