General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6KYJ8",
        "id": "RS7_PHOV8",
        "source_organism": {
            "taxId": "435590",
            "scientificName": "Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)",
            "fullName": "Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)"
        },
        "name": "Small ribosomal subunit protein uS7",
        "description": [
            "One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA"
        ],
        "length": 158,
        "sequence": "MRKAKPKKRVILPDPVFNDQKVSKFVNHLMYDGKKNTSYEIFYAALETVKTKLPNEEKSALEIWKKALDNVTPQIEVKSRRVGGATFQVPTEIRPDRKESISMKNLILFARKRGGKSMADKLAAEIIDAFNEQGGAYKRKEDMHRMAEANRAFAHFRF",
        "proteome": null,
        "gene": "rpsG",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015935",
                "name": "small ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b38a96b66a03eafcff49a4d98ca22b5cde0cd722",
        "counters": {
            "domain_architectures": 57558,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 57558
        }
    }
}