GET /api/protein/UniProt/A6KW52/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A6KW52",
"id": "A6KW52_AEDAE",
"source_organism": {
"taxId": "7159",
"scientificName": "Aedes aegypti",
"fullName": "Aedes aegypti (Yellowfever mosquito)"
},
"name": "tRNA N(3)-methylcytidine methyltransferase",
"description": [
"S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Ser), including tRNA(Ser)(UGA) and tRNA(Ser)(GCU). Interaction with SARS1/SerRS is required for N(3)-methylcytidine methylation"
],
"length": 295,
"sequence": "MSREDNNAPFGQAAKHGSFNLGDVVTNRAKVLTDDEKLRLEEQNKRMVSEFQAGKLETEARKHWDLFYKRNETRFFKDRHWTTREFEELLAGSSASGEDGSIRKTMLEIGCGVGNLVFPLIEDGHRDYFIYACDLSPRAVEMVRQHNLYDEAYMKAFPCDITTGEVFGTIPEGSLDIATLIFVLSAIHPDKFRTVVGNIFRLMKPGGTVLFRDYGLYDMAQLRFKPGHKIAENFYMRQDGTRSYYFAEDEVSNLFSGEGFEVIVNSYIHRRTINQKEGIDVPRIFVQSKFRKPCG",
"proteome": null,
"gene": "AaeL_AAEL012932",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eb9a14d70d4516727bf14e2208cd8a14fcc4dabf",
"counters": {
"domain_architectures": 92911,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"pirsf": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 92911
}
}
}