GET /api/protein/UniProt/A6JSH8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6JSH8",
        "id": "A6JSH8_RAT",
        "source_organism": {
            "taxId": "10116",
            "scientificName": "Rattus norvegicus",
            "fullName": "Rattus norvegicus (Rat)"
        },
        "name": "tRNA (uracil-5-)-methyltransferase homolog A",
        "description": [
            "S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the formation of 5-methyl-uridine in tRNAs and some mRNAs. Mainly catalyzes the methylation of uridine at position 54 (m5U54) in cytosolic tRNAs. Also able to mediate the formation of 5-methyl-uridine in some mRNAs"
        ],
        "length": 615,
        "sequence": "MSEKLDTEVPEHMEDCGQDVSAVGSSAASVCQDEKEDPGPAAGPGTQPGLYSYIRDDLFTSEIFKLELQNVPRHASFSDVRRFLGRFGLQSHKIKLFGQPPCAFVTFRSAAERDKALRVLHGVLWKGRPLSVRLARPKADPMARKRRQEGDNEPTATQIADVVTPLWTVPYTEQLEQKRLECERVLQKLAKEIGNTNHALLPWLLLQRQQHNKACCPLEGVKPSPQQTEYRNKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAPPFDTVHIPQATKQLVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSRRGQAMAIAHFHPQKLSSEEVAGLKASLVCHFMEGPGKASGVTSLYFVEEGQRKTPSQEGLPLEHMAGDQCIQEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQEWAQLDGGSTVLDVCCGTGTIGLALAPKVKKVIGIELCQEAVEDARMNALTNELSNVEFHCGRAEDLVPGLVSKLSSQQLVAVLDPPRAGLHSKVILAMRKAENIKRLLYVSCNPRAAMGNFVDLCRAPSNRVKGTPFHPVKAVAVDLFPQTPHCEMLILFERMQQHPNGIGALEHQDLQTPRNLPDLTAQETETSLSP",
        "proteome": "UP000002494",
        "gene": "Trmt2a",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008173",
                "name": "RNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f072bda7cb7a213bdd54e0bf69713d712f60d8a9",
        "counters": {
            "domain_architectures": 19680,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "ssf": 2,
                "cathgene3d": 3,
                "profile": 2,
                "smart": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19680
        }
    }
}