General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A6BFV2",
        "id": "A6BFV2_9FIRM",
        "source_organism": {
            "taxId": "411462",
            "scientificName": "Dorea longicatena DSM 13814",
            "fullName": "Dorea longicatena DSM 13814"
        },
        "name": "tRNA pseudouridine synthase A",
        "description": [
            "Formation of pseudouridine at positions 38, 39 and 40 in the anticodon stem and loop of transfer RNAs"
        ],
        "length": 244,
        "sequence": "MRTYKLTISYDGSRYQGWQRQATTDNTIQYILEWSIGKLVGYRVHIDGSGRTDAGVHARGQVASVKLSKLYDTKELKDSLNRYLPEDIRIVKVELAKNGFHARKSAKGKKYEYYIDCREKPDVFSRRYCYHYPEKLDIEAMRDATKYLIGPKNFTSFTDDKECKDPIRKITNIKIVSSGEKVRITYYGTGFLYHMVRILTGTLLEIGAGKRDASMLPVVIAAEDRSLAGFLAPARGLFLRKVYY",
        "proteome": null,
        "gene": "truA",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009982",
                "name": "pseudouridine synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0001522",
                "name": "pseudouridine synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009451",
                "name": "RNA modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e266cf367e6ea10878184f0b375dd5ecc46bf6a7",
        "counters": {
            "domain_architectures": 24581,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 24581
        }
    }
}