GET /api/protein/UniProt/A5UUL2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5UUL2",
        "id": "THIM_ROSS1",
        "source_organism": {
            "taxId": "357808",
            "scientificName": "Roseiflexus sp. (strain RS-1)",
            "fullName": "Roseiflexus sp. (strain RS-1)"
        },
        "name": "Hydroxyethylthiazole kinase",
        "description": [
            "Catalyzes the phosphorylation of the hydroxyl group of 4-methyl-5-beta-hydroxyethylthiazole (THZ)"
        ],
        "length": 270,
        "sequence": "MDPINQRIGDMLARIRATRPLIHHITNLVVMNDTANVTLHVGGLPVMAHDAEEVAEMVAHAGALVLNVGTLSPDWIESMLIAGRRANELQTPVVLDPVGAGATQLRTRTNLELLRSLRIAVVRGNGGEIGALSGEGGEVKGVESVSGPEDPLTAARRLAQTYHTVVALTGARDIITDGERVLTVNNGHIWLTTLTGTGCMATTMVAAFAAVERDYLLAAAGGLAMFGLAAELAAEKAHGPASFKVALFDQIYNLTPEQVANGARVVEGGS",
        "proteome": null,
        "gene": "thiM",
        "go_terms": [
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004417",
                "name": "hydroxyethylthiazole kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009228",
                "name": "thiamine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4e3110a261d759c0bf73a8b301deef120cea7fd4",
        "counters": {
            "domain_architectures": 10753,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "hamap": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 10753
        }
    }
}