GET /api/protein/UniProt/A5UDP2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5UDP2",
"id": "FRDD_HAEIE",
"source_organism": {
"taxId": "374930",
"scientificName": "Haemophilus influenzae (strain PittEE)",
"fullName": "Haemophilus influenzae (strain PittEE)"
},
"name": "Fumarate reductase subunit D",
"description": [
"Anchors the catalytic components of the fumarate reductase complex to the cell membrane, binds quinones"
],
"length": 114,
"sequence": "MVDQNPKRSGEPPVWLMFGAGGTVSAIFFPVVILIIGLLLPFGLVDAHNLITFAYSWIGKLVILVLTIFPMWCGLHRIHHGMHDLKVHVPAGGFIFYGLATIYTVWVLFAVINL",
"proteome": null,
"gene": "frdD",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006106",
"name": "fumarate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ceb25760b98104850ec292dcd574d958a721010",
"counters": {
"domain_architectures": 2097,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2097
}
}
}