HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5U8Q7",
"id": "ISPD_MYCTA",
"source_organism": {
"taxId": "419947",
"scientificName": "Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)",
"fullName": "Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)"
},
"name": "2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase",
"description": [
"Catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP)"
],
"length": 231,
"sequence": "MVREAGEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGVVDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSGTAEPEFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGVVLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSLDLPAAEYTDDASLVEHIGGQVQVVDGDPLAFKITTKLDLLLAQAIVRG",
"proteome": "UP000001988",
"gene": "ispD",
"go_terms": [
{
"identifier": "GO:0070567",
"name": "cytidylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050518",
"name": "2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008299",
"name": "isoprenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ca7b4739094c206eca8a003001b55eae54fede06",
"counters": {
"domain_architectures": 20519,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 20519
}
}
}